Worüber bloggt Österreich? In der Blogothek könnt ihr die aktuellsten Beiträge der Österreichischen Blogs durchsuchen. Derzeit befinden sich Blogartikel zum Thema aliciouslyvegan in der Blogothek, die natürlich immer direkt auf eure Blogs verlinken. Es sollte euch also mehr Traffic & neue Leser bringen! Stöbern und Neues entdecken, in der Blogheimat Blogothek!
Möchtet ihr nicht hier erscheinen? Einfach unter "Blog verwalten" die Blogothek Sichtbarkeit auf nein stellen.
Blogbeiträge zum Thema aliciouslyvegan
Aliciouslyvegan: Vegan Caribbean Colombia
Despite my observation that Colombians seem to derive nearly all of their protein from animal-sources, eating vegan turned out to be surprisingly easy.
AliciouslyveganAlicioustravelsbackpackingColombiafoodlifestylerestauranttravellingvegan
Alicioustravels: Finding the Lost City
You hiked the Ciudad Perdida? Was it good? - No, it wasnt good. It was beautiful, humid, often steep, scenic and the most arduous trek Ive ever done
AliciouslyveganAlicioustravelsbackpackingColombiahikingnatureoutdoorstravellingvegan
Aliciouslyvegan: Veganmania 2016
Veganmania 2016 was a blast! It’s getting bigger and better every year. Once more we got to enjoy the vegan life in the sunshine.
AliciouslyveganeventfoodlifestylespringveganVienna
Aliciouslife: My balcony garden – 2016 update
While last year I couldnt wait to get going and planted the first seeds in February, this year I only started playing around in mid-March - hoping for a similar yield.
AliciouslifeAliciouslyveganapartmentAustriabalcony gardenrawspringveganVienna
Aliciouslyvegan: 14 more days with Dr. Bronner
A product so nice Im using it twice. Twice as long as anticipated and two different varieties of the product to be exact.
Aliciouslyveganbackpackinglifestyletravellingvegan
Aliciouslyvegan: 14 days with Dr. Bronner – my results
Now that my two weeks of experimenting with a bar of Dr. Bronner’s neutral pure-castile soap are over, I am quite satisfied with the results.
AliciouslyveganbackpackinglifestyletravellingveganAliciouslyvegan: Unvegan cravings
The question I’ve been asked more than any others since adopting a plant-based lifestyle is But don’t you miss XYZ?.
AliciouslifeAliciouslyveganfoodlifestylevegan
Aliciouslyvegan: Two weeks with Dr Bronner’s pure-castile soap
For the next 2 weeks I will use a bar of Dr. Bronners soap as shower gel, shampoo and face wash and see how many other uses I can get out of it.
Aliciouslyveganbackpackinglifestyletravellingvegan
Aliciouswedding: Let’s talk about the food, baby
Long after your wedding guest will have forgotten about your dress, they will still remember the food served at your wedding.
AliciouslifeAliciouslyveganAll About Weddingsfoodveganwedding